PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00009427-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family ZF-HD
Protein Properties Length: 288aa    MW: 31531.8 Da    PI: 8.0519
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00009427-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer102.72.5e-3272127359
       ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                        vrY+eClkNhAas+Ggha+DGCg+fmps ge+g+ +al+CaAC+CHRnFHRreve 
  PSME_00009427-RA  72 CVRYRECLKNHAASIGGHAIDGCGDFMPS-GEDGSLEALRCAACNCHRNFHRREVEG 127
                       68**************************9.999*********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257748.0E-2366131IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.8E-2973125IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015668.2E-3174125IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152328.22775124IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466892.29E-17205271IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-29209272IPR009057Homeodomain-like
TIGRFAMsTIGR015655.2E-26214270IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MELGEHDSDM GGMALPMLYA GPAPNIHESS KMKPGENGTA GTGTPSGETR PPDHELLQHE  60
HHQQPSVVVK KCVRYRECLK NHAASIGGHA IDGCGDFMPS GEDGSLEALR CAACNCHRNF  120
HRREVEGEPP CYYCYSPRSC GARKRGAGPP MALLGPPSQQ QHPINATPLA LPPTSAHVVA  180
RSLMQGDNDQ DGSSGMSYLN AYGSGSGMMP IVMKKRFRTK FSNEQKEKMC AFAEKVGWRI  240
QKHDDAAVHQ FCMDVGVKRH VLKVWMHNNK SHMLAAKAQR SEEQCTSQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A6e-272152711874ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ1328511e-48FJ132851.2 Pinus taeda isolate 6678 anonymous locus CL2348Contig1_01 genomic sequence.
GenBankFJ1328551e-48FJ132855.2 Pinus taeda isolate 6682 anonymous locus CL2348Contig1_01 genomic sequence.
GenBankFJ1328561e-48FJ132856.2 Pinus taeda isolate 6675 anonymous locus CL2348Contig1_01 genomic sequence.
GenBankFJ1328571e-48FJ132857.2 Pinus taeda isolate 6683 anonymous locus CL2348Contig1_01 genomic sequence.
GenBankFJ1328591e-48FJ132859.2 Pinus taeda isolate 6681 anonymous locus CL2348Contig1_01 genomic sequence.
GenBankFJ1328611e-48FJ132861.2 Pinus taeda isolate 6684 anonymous locus CL2348Contig1_01 genomic sequence.
GenBankFJ1328631e-48FJ132863.2 Pinus taeda isolate 6688 anonymous locus CL2348Contig1_01 genomic sequence.
GenBankJQ2638351e-48JQ263835.1 Pinus radiata isolate 6690 hypothetical protein (CL2348Contig1_01) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001752347.18e-72predicted protein
SwissprotA2Z2592e-60ZHD1_ORYSI; Zinc-finger homeodomain protein 1
TrEMBLA0A0D6R1641e-112A0A0D6R164_ARACU; Uncharacterized protein
STRINGPP1S3_539V6.16e-71(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.28e-60homeobox protein 31